Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS07870 [old locus tag: SP_1597 ]
- pan locus tag?: PNEUPAN002998000
- symbol: SP_RS07870
- pan gene symbol?: pdxU2
- synonym:
- product: ECF transporter S component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS07870 [old locus tag: SP_1597 ]
- symbol: SP_RS07870
- product: ECF transporter S component
- replicon: chromosome
- strand: -
- coordinates: 1501234..1501695
- length: 462
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (1501234..1501695) NCBI
- BioCyc:
- MicrobesOnline: see SP_1597
- PneumoBrowse for strain D39V: SPV_1422 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAGCAAACAAAAACAACTAAAATCGCCCTTGTATCCCTATTAACCGCCCTTTCTGTG
GTTCTAGGTTATTTCTTAAAAATCCCAACACCTACAGGAATTCTAACTCTTTTAGATGCT
GGTGTCTTCTTTGCGGCCTTTTACTTTGGTAGTCGTGAAGGAGCGGTAGTCGGAGGACTA
GCAAGTTTCTTGATTGACCTCTTATCAGGCTACCCTCAGTGGATGTTCTTTAGCTTGGTC
AACCATGGCTTGCAGGGATTTTTCGCAGGATTTAAAGGAAAAAGTCAGTGGTTAGGCCTT
ATTTTAGCAACTATTGCCATGGTAGGAGGCTACGCCTTGGGTTCTGCTTTGATGAATGGC
TGGGCAGCAGCCCTCCCAGAAATTCTACCGAATTTTATGCAAAATATGGTAGGGATGATT
GTAGGATTTATTCTTAGTCAAAGTATCAAGAAGATTAAGTAA60
120
180
240
300
360
420
462
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS07870 [old locus tag: SP_1597 ]
- symbol: SP_RS07870
- description: ECF transporter S component
- length: 153
- theoretical pI: 10.365
- theoretical MW: 16375.5
- GRAVY: 0.828105
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate ECF transporter S component, folate family (TIGR04518; HMM-score: 31.1)Transport and binding proteins Unknown substrate putative energy coupling factor transporter S component (TIGR04522; HMM-score: 25.7)and 1 moreUnknown function General TIGR04002 family protein (TIGR04002; HMM-score: 17.7)
- TheSEED: see SP_1597
- PFAM: Gx_transp (CL0315) ECF-ribofla_trS; ECF-type riboflavin transporter, S component (PF07155; HMM-score: 115.9)and 6 moreECF_trnsprt; ECF transporter, substrate-specific component (PF12822; HMM-score: 37.5)LysE (CL0292) UPF0016; Uncharacterized protein family UPF0016 (PF01169; HMM-score: 11.1)no clan defined DUF5455; Family of unknown function (DUF5455) (PF17537; HMM-score: 10.7)DUF4118; Domain of unknown function (DUF4118) (PF13493; HMM-score: 10.1)FixP_N; N-terminal domain of cytochrome oxidase-cbb3, FixP (PF14715; HMM-score: 6.9)CPP1-like; Protein CHAPERONE-LIKE PROTEIN OF POR1-like (PF11833; HMM-score: 6.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0037
- Cytoplasmic Membrane Score: 0.9947
- Cell wall & surface Score: 0
- Extracellular Score: 0.0015
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.037797
- TAT(Tat/SPI): 0.000437
- LIPO(Sec/SPII): 0.012435
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQTKTTKIALVSLLTALSVVLGYFLKIPTPTGILTLLDAGVFFAAFYFGSREGAVVGGLASFLIDLLSGYPQWMFFSLVNHGLQGFFAGFKGKSQWLGLILATIAMVGGYALGSALMNGWAAALPEILPNFMQNMVGMIVGFILSQSIKKIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1422 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)