Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 05-OCT-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae MDRSPN001
- locus tag: MDRSPN_00189 [new locus tag: MDRSPN_RS01025 ]
- pan locus tag?: PNEUPAN000935000
- symbol: nrdG
- pan gene symbol?: nrdG
- synonym:
- product: anaerobic ribonucleoside-triphosphate reductase-activating protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: MDRSPN_00189 [new locus tag: MDRSPN_RS01025 ]
- symbol: nrdG
- product: anaerobic ribonucleoside-triphosphate reductase-activating protein
- replicon: chromosome
- strand: +
- coordinates: 186439..187029
- length: 591
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP018391 (186439..187029) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0190 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAATAATCCAAAACCACAAGAATGGAAAAGCGAGGAACTTAGTCAAGGTCGTATCATT
GACTACAAGGCCTTTAACTTTGTTGATGGCGAAGGCGTGCGTAACTCTCTCTATGTATCA
GGCTGTATGTTTCACTGCGAGGGATGTTATAATGTTGCGACTTGGTCTTTTAATGCTGGC
ATTCTCTATACAGCAGAATTAGAAGAGCAGATTATGGCAGACCTTGCCCAACCCTATGTT
CAAGGCTTGACTTTGCTGGGAGGGGAGCCTTTTCTTAATACTGGCATTCTCTTGCCTCTA
GTTAAACGCATCCGAAAGGAATTGCCAGACAAGGACATTTGGTCCTGGACCGGCTACACT
TGGGAAGAAATGATGTTGGAAACTCCAGATAAACTGGAACTCTTATCATTGATTGACATT
CTTGTCGATGGACGATACGATCGAACTAAGAGAAATCTCATGCTCCAGTTTCGAGGTTCG
TCCAACCAACGAATTATCGATGTGCAAAAATCGCTCAAAAGTGGGCAAGTAGTGATTTGG
GACAAGCTCAATGACGGAAAAGAAAGCTATGAACAGGTGAAGAGAGAATGA60
120
180
240
300
360
420
480
540
591
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: MDRSPN_00189 [new locus tag: MDRSPN_RS01025 ]
- symbol: NrdG
- description: anaerobic ribonucleoside-triphosphate reductase-activating protein
- length: 196
- theoretical pI: 4.71159
- theoretical MW: 22650.7
- GRAVY: -0.431122
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 197)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02491; EC 1.97.1.-; HMM-score: 197)and 16 morePurines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02826; EC 1.97.1.-; HMM-score: 49.4)Protein fate Protein modification and repair pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 46.9)Energy metabolism Anaerobic pyruvate formate-lyase 1-activating enzyme (TIGR02493; EC 1.97.1.4; HMM-score: 46.9)glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 35.9)Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 33.9)Protein fate Protein modification and repair anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29.2)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism anaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29.2)Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 22.6)Protein synthesis tRNA and rRNA base modification putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 21)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin heme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 17.9)Protein fate Protein modification and repair [benzylsuccinate synthase]-activating enzyme (TIGR04003; EC 1.97.-.-; HMM-score: 17.6)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 16.4)pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 14.7)His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 13.8)putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 12.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin putative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 12.6)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: 4Fe-4S (CL0344) Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 172.2)and 2 moreFer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 102)TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 26.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9537
- Cytoplasmic Membrane Score: 0.0117
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0343
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.231534
- TAT(Tat/SPI): 0.00085
- LIPO(Sec/SPII): 0.004226
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBA58395 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVSGCMFHCEGCYNVATWSFNAGILYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRIRKELPDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0190 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]